Recombinant Human ERK5/BMK1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ERK5/BMK1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 561-677 of Human MAPK7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAPK7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERK5/BMK1 Protein

  • Big MAP kinase 1
  • BMK1 kinase
  • BMK1
  • BMK-1
  • BMK1EC 2.7.11.24
  • EC 2.7.11
  • ERK5
  • ERK-5
  • ERK5MAPK 7
  • Extracellular signal-regulated kinase 5
  • extracellular-signal-regulated kinase 5
  • MAP kinase 7
  • MAPK7
  • mitogen-activated protein kinase 7
  • PRKM7ERK4

Background

MAPK7 - mitogen-activated protein kinase 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01) (0)

There are no publications for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01) (0)

There are no reviews for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERK5/BMK1 Products

Bioinformatics Tool for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01)

Discover related pathways, diseases and genes to ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01)

Discover more about diseases related to ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01).
 

Pathways for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01)

View related products by pathway.

PTMs for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01)

Learn more about PTMs related to ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01).
 

Research Areas for ERK5/BMK1 Partial Recombinant Protein (H00005598-Q01)

Find related products by research area.

Blogs on ERK5/BMK1

There are no specific blogs for ERK5/BMK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERK5/BMK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK7
Entrez