ERCC6L Antibody

Images

 
Immunohistochemistry-Paraffin: ERCC6L Antibody [NBP2-13969] - Staining of human tonsil shows nuclear positivity in a subset of cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERCC6L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLL SARACCLLNLGTFSAQDGNEGEDSPDVDHIDQVTDDTLMEESGKMIFLMD LL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERCC6L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERCC6L Protein (NBP2-13969PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERCC6L Antibody

  • ATP-dependent helicase ERCC6-like
  • DNA excision repair protein ERCC-6-like
  • EC 3.6.1
  • EC 3.6.4.12
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 6-like
  • excision repair protein ERCC6-like
  • FLJ20105
  • MGC131695
  • PICHexcision repair cross-complementing rodent repair deficiency complementationgroup 6 - like
  • PLK1-interacting checkpoint helicase
  • SNF2/RAD54 family protein
  • Tumor antigen BJ-HCC-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
AF4185
Species: Hu
Applications: ICC
NB100-1720
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
PPS037
Species: Hu, Mu, Rt, Xp
Applications: WB
NLS6871
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Xp
Applications: IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009700-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
NBP2-13969
Species: Hu
Applications: IHC, IHC-P

Publications for ERCC6L Antibody (NBP2-13969) (0)

There are no publications for ERCC6L Antibody (NBP2-13969).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERCC6L Antibody (NBP2-13969) (0)

There are no reviews for ERCC6L Antibody (NBP2-13969). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ERCC6L Antibody (NBP2-13969) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERCC6L Products

Bioinformatics Tool for ERCC6L Antibody (NBP2-13969)

Discover related pathways, diseases and genes to ERCC6L Antibody (NBP2-13969). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERCC6L Antibody (NBP2-13969)

Discover more about diseases related to ERCC6L Antibody (NBP2-13969).
 

Pathways for ERCC6L Antibody (NBP2-13969)

View related products by pathway.

PTMs for ERCC6L Antibody (NBP2-13969)

Learn more about PTMs related to ERCC6L Antibody (NBP2-13969).
 

Research Areas for ERCC6L Antibody (NBP2-13969)

Find related products by research area.

Blogs on ERCC6L

There are no specific blogs for ERCC6L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERCC6L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERCC6L