ErbB3/Her3 Antibody

Images

 
Western Blot: ErbB3/Her3 Antibody [NBP2-33289] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: SK-MEL-30
Immunohistochemistry: ErbB3/Her3 Antibody [NBP2-33289] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ErbB3/Her3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERBB3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ErbB3/Her3 Protein (NBP2-33289PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ErbB3/Her3 Antibody

  • c-erbB3
  • EC 2.7.10
  • EC 2.7.10.1
  • ErbB3
  • ErbB-3
  • erbB3-S
  • HER3
  • HER3c-erbB-3
  • LCCS2
  • lethal congenital contracture syndrome 2
  • MDA-BF-1
  • MGC88033
  • p180-ErbB3
  • p45-sErbB3
  • p85-sErbB3
  • Proto-oncogene-like protein c-ErbB-3
  • receptor tyrosine-protein kinase erbB-3
  • Tyrosine kinase-type cell surface receptor HER3
  • v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1905
Species: Mu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for ErbB3/Her3 Antibody (NBP2-33289) (0)

There are no publications for ErbB3/Her3 Antibody (NBP2-33289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ErbB3/Her3 Antibody (NBP2-33289) (0)

There are no reviews for ErbB3/Her3 Antibody (NBP2-33289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ErbB3/Her3 Antibody (NBP2-33289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ErbB3/Her3 Products

Bioinformatics Tool for ErbB3/Her3 Antibody (NBP2-33289)

Discover related pathways, diseases and genes to ErbB3/Her3 Antibody (NBP2-33289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ErbB3/Her3 Antibody (NBP2-33289)

Discover more about diseases related to ErbB3/Her3 Antibody (NBP2-33289).
 

Pathways for ErbB3/Her3 Antibody (NBP2-33289)

View related products by pathway.

PTMs for ErbB3/Her3 Antibody (NBP2-33289)

Learn more about PTMs related to ErbB3/Her3 Antibody (NBP2-33289).
 

Research Areas for ErbB3/Her3 Antibody (NBP2-33289)

Find related products by research area.

Blogs on ErbB3/Her3

There are no specific blogs for ErbB3/Her3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ErbB3/Her3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERBB3
Entrez
Uniprot