Recombinant Human ER beta/NR3A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ER beta/NR3A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human ESR2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPRCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ESR2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 1 Review rated 4
using
H00002100-P01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ER beta/NR3A2 Protein

  • ER beta
  • Erb
  • ER-beta
  • ESR2
  • ESR-BETA
  • ESTRB
  • estrogen receptor 2 (ER beta)
  • estrogen receptor beta 4
  • estrogen receptor beta
  • NR3A2
  • NR3A2ESRB
  • Nuclear receptor subfamily 3 group A member 2

Background

ESR2( AAH24181, 1 a.a. - 324 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-07799
Species: Hu
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF

Publications for ER beta/NR3A2 Recombinant Protein (H00002100-P01) (0)

There are no publications for ER beta/NR3A2 Recombinant Protein (H00002100-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for ER beta/NR3A2 Recombinant Protein (H00002100-P01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.
We have 1 review tested in 1 application: WB.

Reviews using H00002100-P01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Rat 05/15/2012
View

Summary

ApplicationWestern Blot
Sample TestedBrain
SpeciesRat

Blocking

Blocking Details5 % milk

Primary Anitbody

Dilution Ratio1:1000, overnight, 4 degrees, 1% bsa

Details

Detection Notes20 minutes

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ER beta/NR3A2 Recombinant Protein (H00002100-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ER beta/NR3A2 Products

Bioinformatics Tool for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

Discover related pathways, diseases and genes to ER beta/NR3A2 Recombinant Protein (H00002100-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

Discover more about diseases related to ER beta/NR3A2 Recombinant Protein (H00002100-P01).
 

Pathways for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

View related products by pathway.

PTMs for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

Learn more about PTMs related to ER beta/NR3A2 Recombinant Protein (H00002100-P01).

Blogs on ER beta/NR3A2

There are no specific blogs for ER beta/NR3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Anonymous
05/15/2012
Application: WB
Species: Rat

Bioinformatics

Gene Symbol ESR2
Entrez