Recombinant Human ER beta/NR3A2 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ER beta/NR3A2 Protein [H00002100-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human ER beta/NR3A2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human ESR2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPRCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ESR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
61.16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4
using
H00002100-P01 in the following applications:

Publications
Read Publication using H00002100-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ER beta/NR3A2 GST (N-Term) Protein

  • ER beta
  • Erb
  • ER-beta
  • ESR2
  • ESR-BETA
  • ESTRB
  • estrogen receptor 2 (ER beta)
  • estrogen receptor beta 4
  • estrogen receptor beta
  • NR3A2
  • NR3A2ESRB
  • Nuclear receptor subfamily 3 group A member 2

Background

ESR2( AAH24181, 1 a.a. - 324 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DY262
Species: Hu
Applications: ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-47927
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45388
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB

Publications for ER beta/NR3A2 Recombinant Protein (H00002100-P01)(1)

Review for ER beta/NR3A2 Recombinant Protein (H00002100-P01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using H00002100-P01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
  4
reviewed by:
Verified Customer
WB Rat 05/15/2012
View

Summary

ApplicationWestern Blot
Sample TestedBrain
SpeciesRat

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ER beta/NR3A2 Recombinant Protein (H00002100-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ER beta/NR3A2 Products

Diseases for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

Discover more about diseases related to ER beta/NR3A2 Recombinant Protein (H00002100-P01).
 

Pathways for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

View related products by pathway.

PTMs for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

Learn more about PTMs related to ER beta/NR3A2 Recombinant Protein (H00002100-P01).
 

Research Areas for ER beta/NR3A2 Recombinant Protein (H00002100-P01)

Find related products by research area.

Blogs on ER beta/NR3A2

There are no specific blogs for ER beta/NR3A2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

 
Verified Customer
05/15/2012
Application: WB
Species: Rat

Bioinformatics

Gene Symbol ESR2