Recombinant Human EPHX2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EPHX2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human EPHX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EPHX2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EPHX2 Protein

  • CEH
  • Cytosolic epoxide hydrolase
  • EC 3.3.2.10
  • Epoxide hydratase
  • epoxide hydrolase 2
  • epoxide hydrolase 2, cytoplasmic
  • epoxide hydrolase 2, cytosolic
  • epoxide hydrolase, soluble
  • SEH
  • Soluble epoxide hydrolase

Background

EPHX2 - epoxide hydrolase 2, cytoplasmic

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00001551-B01P
Species: Hu
Applications: WB
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP2-01286
Species: Hu
Applications: WB, IHC, IHC-P
H00002053-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for EPHX2 Partial Recombinant Protein (H00002053-Q01) (0)

There are no publications for EPHX2 Partial Recombinant Protein (H00002053-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPHX2 Partial Recombinant Protein (H00002053-Q01) (0)

There are no reviews for EPHX2 Partial Recombinant Protein (H00002053-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPHX2 Partial Recombinant Protein (H00002053-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EPHX2 Products

Bioinformatics Tool for EPHX2 Partial Recombinant Protein (H00002053-Q01)

Discover related pathways, diseases and genes to EPHX2 Partial Recombinant Protein (H00002053-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPHX2 Partial Recombinant Protein (H00002053-Q01)

Discover more about diseases related to EPHX2 Partial Recombinant Protein (H00002053-Q01).
 

Pathways for EPHX2 Partial Recombinant Protein (H00002053-Q01)

View related products by pathway.

PTMs for EPHX2 Partial Recombinant Protein (H00002053-Q01)

Learn more about PTMs related to EPHX2 Partial Recombinant Protein (H00002053-Q01).
 

Research Areas for EPHX2 Partial Recombinant Protein (H00002053-Q01)

Find related products by research area.

Blogs on EPHX2

There are no specific blogs for EPHX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CYP1B1 Antibody
NBP2-24722

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EPHX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EPHX2