EPHX2 Antibody [FITC] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 30-240 of human EPHX2 (NP_001970.2).
Sequence: LALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EPHX2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
0.05% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for EPHX2 Antibody [FITC]
Background
EPHX2 encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for EPHX2 Antibody (NBP3-35892F) (0)
There are no publications for EPHX2 Antibody (NBP3-35892F).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EPHX2 Antibody (NBP3-35892F) (0)
There are no reviews for EPHX2 Antibody (NBP3-35892F).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EPHX2 Antibody (NBP3-35892F) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EPHX2 Products
Research Areas for EPHX2 Antibody (NBP3-35892F)
Find related products by research area.
|
Blogs on EPHX2