EphB2 Antibody - BSA Free

Western Blot: EphB2 Antibody [NBP2-56605] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: EphB2 Antibody [NBP2-56605] - Staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EphB2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EphB2 Antibody - BSA Free (NBP2-56605) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPHB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EphB2 Recombinant Protein Antigen (NBP2-56605PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EphB2 Antibody - BSA Free

• CAPB
• Cek5
• Drt
• DRTEphB2
• EC 2.7.10
• EC 2.7.10.1
• EK5
• elk-related tyrosine kinase
• EPH receptor B2
• eph tyrosine kinase 3
• EphB2
• EPH-like kinase 5
• ephrin type-B receptor 2
• EPHT3MGC87492
• EPTH3
• Erk
• ERKHek5
• Hek5
• Nuk
• PCBC
• protein-tyrosine kinase HEK5
• Qek2
• Renal carcinoma antigen NY-REN-47
• Sek3
• Tyro5
• Tyrosine-protein kinase receptor EPH-3
• Tyrosine-protein kinase TYRO5

Background

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPHB2