Recombinant Human EPCR Protein

Images

 
SDS-Page: Recombinant Human EPCR Protein [H00010544-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human EPCR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-238 of Human PROCR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGGFIIAGVAVGIFLCTGGRRC

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PROCR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
51.92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00010544-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EPCR Protein

  • APC receptor
  • CCCA
  • CCD41
  • CCD41centrosome-associated protein
  • CD201 antigen
  • CD201
  • centrocyclin
  • Endothelial cell protein C receptor
  • endothelial protein C receptor
  • EPCR
  • EPCRMGC23024
  • PROCR
  • protein C receptor, endothelial

Background

PROCR( AAH14451, 1 a.a. - 239 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67731
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-58268
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Sh, Ze
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP2-78293
Species: Hu
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EPCR Recombinant Protein (H00010544-P01)(3)

Reviews for EPCR Recombinant Protein (H00010544-P01) (0)

There are no reviews for EPCR Recombinant Protein (H00010544-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPCR Recombinant Protein (H00010544-P01). (Showing 1 - 1 of 1 FAQs).

  1. Could you please send me the sequence of the GST-tag of this protein? 
    • Yes, the GST-tag+Linker sequence is:MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDP

Other Available Formats

Additional EPCR Products

Bioinformatics Tool for EPCR Recombinant Protein (H00010544-P01)

Discover related pathways, diseases and genes to EPCR Recombinant Protein (H00010544-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPCR Recombinant Protein (H00010544-P01)

Discover more about diseases related to EPCR Recombinant Protein (H00010544-P01).
 

Pathways for EPCR Recombinant Protein (H00010544-P01)

View related products by pathway.

PTMs for EPCR Recombinant Protein (H00010544-P01)

Learn more about PTMs related to EPCR Recombinant Protein (H00010544-P01).

Blogs on EPCR

There are no specific blogs for EPCR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EPCR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PROCR