ENY2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ENY2 Antibody [NBP1-90598] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ENY2 Antibody [NBP1-90598] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENY2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENY2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ENY2 Protein (NBP1-90598PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ENY2 Antibody

  • DC6
  • enhancer of yellow 2 homolog (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83393
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49644
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP2-56183
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
557-NT/CF
Species: Rt
NBP2-14410
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16453
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56633
Species: Hu
Applications: WB
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
H00005694-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-01832
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P

Publications for ENY2 Antibody (NBP1-90598) (0)

There are no publications for ENY2 Antibody (NBP1-90598).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENY2 Antibody (NBP1-90598) (0)

There are no reviews for ENY2 Antibody (NBP1-90598). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ENY2 Antibody (NBP1-90598) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENY2 Products

ENY2 NBP1-90598

Bioinformatics Tool for ENY2 Antibody (NBP1-90598)

Discover related pathways, diseases and genes to ENY2 Antibody (NBP1-90598). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENY2 Antibody (NBP1-90598)

Discover more about diseases related to ENY2 Antibody (NBP1-90598).
 

Pathways for ENY2 Antibody (NBP1-90598)

View related products by pathway.

PTMs for ENY2 Antibody (NBP1-90598)

Learn more about PTMs related to ENY2 Antibody (NBP1-90598).

Blogs on ENY2

There are no specific blogs for ENY2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENY2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENY2