ENTPD8 Antibody

Images

 
Western Blot: ENTPD8 Antibody [NBP1-59484] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ENTPD8 Antibody Summary

Immunogen
Synthetic peptides corresponding to ENTPD8(ectonucleoside triphosphate diphosphohydrolase 8) The peptide sequence was selected from the N terminal of ENTPD8. Peptide sequence IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ENTPD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ENTPD8 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ENTPD8 Antibody

  • EC 3.6.1
  • EC 3.6.1.5
  • ecto-ATP-diphosphohydrolase
  • ectonucleoside triphosphate diphosphohydrolase 8
  • E-NTPDase 8
  • GLSR2492
  • liver ecto-ATP-diphosphohydrolase
  • NTPDase 8
  • NTPDase8
  • NTPDase-8
  • nucleoside triphosphate diphosphohydrolase-8
  • UNQ2492

Background

ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90071
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-85752
Species: Hu
Applications: WB, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-57614
Species: Hu
Applications: ICC/IF
MAB5756
Species: Hu
Applications: Flow
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59484
Species: Hu
Applications: WB

Publications for ENTPD8 Antibody (NBP1-59484) (0)

There are no publications for ENTPD8 Antibody (NBP1-59484).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENTPD8 Antibody (NBP1-59484) (0)

There are no reviews for ENTPD8 Antibody (NBP1-59484). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ENTPD8 Antibody (NBP1-59484) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ENTPD8 Products

Bioinformatics Tool for ENTPD8 Antibody (NBP1-59484)

Discover related pathways, diseases and genes to ENTPD8 Antibody (NBP1-59484). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENTPD8 Antibody (NBP1-59484)

Discover more about diseases related to ENTPD8 Antibody (NBP1-59484).
 

Pathways for ENTPD8 Antibody (NBP1-59484)

View related products by pathway.

PTMs for ENTPD8 Antibody (NBP1-59484)

Learn more about PTMs related to ENTPD8 Antibody (NBP1-59484).

Blogs on ENTPD8

There are no specific blogs for ENTPD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ENTPD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ENTPD8
Uniprot