ENTPD8 Antibody - BSA Free

Western Blot: ENTPD8 Antibody [NBP1-59484] - Human Lung lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ENTPD8 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ENTPD8(ectonucleoside triphosphate diphosphohydrolase 8) The peptide sequence was selected from the N terminal of ENTPD8. Peptide sequence IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ENTPD8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ENTPD8 Antibody - BSA Free

• EC 3.6.1
• EC 3.6.1.5
• ecto-ATP-diphosphohydrolase
• ectonucleoside triphosphate diphosphohydrolase 8
• E-NTPDase 8
• GLSR2492
• liver ecto-ATP-diphosphohydrolase
• NTPDase 8
• NTPDase8
• NTPDase-8
• nucleoside triphosphate diphosphohydrolase-8
• UNQ2492

Background

ENTPD8 is the canalicular ectonucleoside NTPDase responsible for the main hepatic NTPDase activity. Ectonucleoside NTPDases catalyze the hydrolyzis of gamma- and beta-phosphate residues of nucleotides, playing a central role in concentration of extracellular nucleotides. It has activity toward ATP, ADP, UTP and UDP, but not toward AMP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ENTPD8
• Uniprot:
  • Q5MY95(Human)