ENT1 Recombinant Protein Antigen

Images

 
There are currently no images for ENT1 Protein (NBP1-84838PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ENT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC29A1.

Source: E. coli

Amino Acid Sequence: RLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC29A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84838.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ENT1 Recombinant Protein Antigen

  • ENT1
  • ENT1es-type
  • equilibrative nucleoside transporter 1
  • MGC1465
  • MGC3778
  • SLC29A1
  • solute carrier family 29 (nucleoside transporters), member 1
  • Solute carrier family 29 member 1
  • solute carrier family 29, member 1

Background

ENT1 is a member of the equilibrative nucleoside transporter family. The gene encodes a transmembrane glycoprotein that localizes to the plasma and mitochondrial membranes and mediates the cellular uptake of nucleosides from the surrounding medium. The protein is categorized as an equilibrative (as opposed to concentrative) transporter that is sensitive to inhibition by nitrobenzylthioinosine (NBMPR). Nucleoside transporters are required for nucleotide synthesis in cells that lack de novo nucleoside synthesis pathways, and are also necessary for the uptake of cytotoxic nucleosides used for cancer and viral chemotherapies. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-33206
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
NBP2-38763
Species: Hu
Applications: IHC, IHC-P
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP3-25643
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84418
Species: Hu
Applications: IHC, IHC-P, WB
NB100-368
Species: Hu, Mu
Applications: WB
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41314
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
AF1235
Species: Hu
Applications: IHC, WB
NBP2-81829
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-94094
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
H00022978-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for ENT1 Protein (NBP1-84838PEP) (0)

There are no publications for ENT1 Protein (NBP1-84838PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENT1 Protein (NBP1-84838PEP) (0)

There are no reviews for ENT1 Protein (NBP1-84838PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ENT1 Protein (NBP1-84838PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ENT1 Products

Research Areas for ENT1 Protein (NBP1-84838PEP)

Find related products by research area.

Blogs on ENT1

There are no specific blogs for ENT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ENT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC29A1