EN-RAGE/S100A12 Recombinant Protein Antigen

Images

 
There are currently no images for EN-RAGE/S100A12 Protein (NBP1-86694PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EN-RAGE/S100A12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A12.

Source: E. coli

Amino Acid Sequence: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
S100A12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86694.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EN-RAGE/S100A12 Recombinant Protein Antigen

  • CAAF1
  • CAAF1Neutrophil S100 protein
  • CAAFI
  • CAGC
  • CAGCS100 calcium binding protein A12 (calgranulin C)
  • CAGCS100
  • Calcium-binding protein in amniotic fluid 1
  • Calgranulin C
  • calgranulin-C
  • CGRPEN-RAGE
  • ENRAGE
  • EN-RAGE
  • Extracellular newly identified RAGE-binding protein
  • MRP6
  • p6calgranulin C
  • protein S100-A12
  • S100 calcium binding protein A12
  • S100 calcium-binding protein A12 (calgranulin C)
  • S100 calcium-binding protein A12
  • S100A12

Background

S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A12 is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. S100A12 is also a ligand for RAGE. Interaction with RAGE on mononuclear phagocytes, lymphocytes and endothelium triggers cellular activation. Nuclear factor kappa B--a key transcription factor for inflammatory events--is activated by S100A12/RAGE. S100A12 has also been shown to have anti-microbial properties.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: IHC, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC, IHC-P, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
AF6428
Species: Hu
Applications: IHC, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP1-71774
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: IHC, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-18225
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB

Publications for EN-RAGE/S100A12 Protein (NBP1-86694PEP) (0)

There are no publications for EN-RAGE/S100A12 Protein (NBP1-86694PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EN-RAGE/S100A12 Protein (NBP1-86694PEP) (0)

There are no reviews for EN-RAGE/S100A12 Protein (NBP1-86694PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EN-RAGE/S100A12 Protein (NBP1-86694PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EN-RAGE/S100A12 Products

Research Areas for EN-RAGE/S100A12 Protein (NBP1-86694PEP)

Find related products by research area.

Blogs on EN-RAGE/S100A12

There are no specific blogs for EN-RAGE/S100A12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EN-RAGE/S100A12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol S100A12