EMR4P Antibody (2H8) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: EMR4P Antibody (2H8) [H00326342-M01] - Analysis of monoclonal antibody to EMR4P on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: EMR4P Antibody (2H8) [H00326342-M01] - Detection limit for recombinant GST tagged EMR4 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2H8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EMR4P Antibody (2H8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse EMR4P Antibody (2H8) - Azide and BSA Free (H00326342-M01) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: EMR4 (XP_377506, 21 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
• Specificity: EMR4 - egf-like module containing, mucin-like, hormone receptor-like 4
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ADGRE4P
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EMR4P Antibody (2H8) - Azide and BSA Free

• egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene
• egf-like module containing, mucin-like, hormone receptor-like 4
• Egf-tm7
• EMR4
• EMR4EGF-like module receptor 4
• Fire
• Gpr127
• GPR127G-protein coupled receptor 127
• G-protein coupled receptor PGR16
• PGR16
• PGR16G protein-coupled receptor 127

Background

This gene is a member of the EGF-TM7 receptor gene family which is thought to play a role in leukocyte adhesion and migration. In other vertebrates, including nonhuman primates, this gene encodes a protein containing N-terminal EGF domains and a C-terminal transmembrane domain. Sequence evidence for the human gene, however, indicates nucleotide deletion in the genomic sequence would result in frameshift and early termination of translation. Thus, the protein would lack a transmembrane domain and the protein encoded by this gene would be soluble rather than expressed on the cell surface. As the encoded protein has not been detected, the possibility also exists that this gene may represent a transcribed pseudogene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADGRE4P
• Entrez:
  • 326342(Human)