EMAP-II/AIMP1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

EMAP-II/AIMP1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AIMP1.
  
  

  Source: E. coli

  Amino Acid Sequence: CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AIMP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84851.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EMAP-II/AIMP1 Recombinant Protein Antigen

• AIMP1
• aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
• EMAP-2
• EMAPII
• EMAP-II
• EMAPIImember 1 (endothelialmonocyte-activating)
• endothelial-monocyte activating polypeptide II
• Multisynthase complex auxiliary component p43
• multisynthetase complex auxiliary component p43
• SCYE1

Background

EMAP II (Endothelial-Monocyte-Activating Polypeptide II) is a proinflammatory cytokine and chemoattractant of macrophages and polymorphonuclear lymphocytes. EMAP II is synthesized as a 34 kDa precursor molecule which is cleaved to a biologically active 22 kDa mature polypeptide. This active protein is known to induce the procoagulant protein tissue factor on the surface of endothelial cells and modulate other properties of endothelial cells and monocytes in vitro, including the stimulation of TNF-alpha and myeloperoxidase. EMAP II activates neutrophils in vivo and induces an inflammatory reaction and tumor regression. EMAP II induces apoptosis in proliferating endothelial cells and inhibits neovascularization. This anti-angiogenic property is of interest to tumor biology. EMAP II is also a negative modulator of lung vascular growth.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: AIMP1