ELOVL1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELOVL1. Peptide sequence: RGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ELOVL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ELOVL1 Antibody - BSA Free
Background
Elongation of very long chain fatty acid-like (ELOVL) proteins 1-6 are members of the ELO family of proteins, which play an important role in tissue-specific biosynthesis of very long chain fatty acids and sphingolipids. The ELOVL proteins act as catalysts in fatty acid elongation reduction and localize to the endoplasmic reticulum (ER). Elongation of very long chain fatty acids protein 1 (ELOVL1), also referred to as Ssc1, is the human homolog of the yeast ELO3 protein. It is expressed in a variety of tissues and at especially high levels in stomach, skin, intestine, kidney and lung. ELOVL1 participates in the elongation of very long chain saturated and monounsaturated fatty acids of up to 26 carbons and may be required for the development of a barrier in epithelial cells and skin. ELOVL1 is also important for the formation of Myelin in the central nervous system. Impaired ELOVL1 activity may be associated with disorders of sphingolipid metabolism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, KO, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Publications for ELOVL1 Antibody (NBP2-82997) (0)
There are no publications for ELOVL1 Antibody (NBP2-82997).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELOVL1 Antibody (NBP2-82997) (0)
There are no reviews for ELOVL1 Antibody (NBP2-82997).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ELOVL1 Antibody (NBP2-82997) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ELOVL1 Products
Blogs on ELOVL1