ELMOD2 Antibody

Images

 
Western Blot: ELMOD2 Antibody [NBP2-13956] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ELMOD2 Antibody [NBP2-13956] - Immunofluorescent staining of human cell line BJ shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: ELMOD2 Antibody [NBP2-13956] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELMOD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYL DVESVRKRPYDSDNLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELMOD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ELMOD2 Protein (NBP2-13956PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ELMOD2 Antibody

  • ELMO domain containing 2
  • ELMO domain-containing protein 2,9830169G11Rik
  • ELMO/CED-12 domain containing 2
  • FLJ35768
  • FLJ38038
  • MGC10084

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79667
Species: Hu
Applications: WB
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-98277
Species: Hu
Applications: WB
NBP1-91680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-879
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-875
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA
AF3147
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBL1-11228
Species: Hu
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ELMOD2 Antibody (NBP2-13956) (0)

There are no publications for ELMOD2 Antibody (NBP2-13956).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELMOD2 Antibody (NBP2-13956) (0)

There are no reviews for ELMOD2 Antibody (NBP2-13956). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ELMOD2 Antibody (NBP2-13956) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELMOD2 Products

Bioinformatics Tool for ELMOD2 Antibody (NBP2-13956)

Discover related pathways, diseases and genes to ELMOD2 Antibody (NBP2-13956). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELMOD2 Antibody (NBP2-13956)

Discover more about diseases related to ELMOD2 Antibody (NBP2-13956).
 

Pathways for ELMOD2 Antibody (NBP2-13956)

View related products by pathway.

Research Areas for ELMOD2 Antibody (NBP2-13956)

Find related products by research area.

Blogs on ELMOD2

There are no specific blogs for ELMOD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELMOD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELMOD2