ELMO2 Recombinant Protein Antigen

Images

 
There are currently no images for ELMO2 Protein (NBP1-84554PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ELMO2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ELMO2.

Source: E.coli

Amino Acid Sequence: CDGWSLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSAD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELMO2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-84554.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ELMO2 Recombinant Protein Antigen

  • ced-12 homolog 2
  • CED12A
  • ELMO-2
  • engulfment and cell motility 2 (ced-12 homolog, C. elegans)
  • engulfment and cell motility 2
  • engulfment and cell motility protein 2
  • FLJ11656
  • hCed-12A
  • KIAA1834CED12CED-12
  • PH domain protein CED12A
  • Protein ced-12 homolog A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
42080002
Species: Ce
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-875
Species: Hu, Mu, Rt
Applications: WB, IP, PEP-ELISA
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-84553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
AF6260
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-873
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-88832
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-71693
Species: Hu
Applications: WB, ICC/IF
NBP2-45641
Species: Hu
Applications: WB, IHC
NBP1-47745
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ELMO2 Protein (NBP1-84554PEP) (0)

There are no publications for ELMO2 Protein (NBP1-84554PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELMO2 Protein (NBP1-84554PEP) (0)

There are no reviews for ELMO2 Protein (NBP1-84554PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ELMO2 Protein (NBP1-84554PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ELMO2 Protein (NBP1-84554PEP)

Discover related pathways, diseases and genes to ELMO2 Protein (NBP1-84554PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELMO2 Protein (NBP1-84554PEP)

Discover more about diseases related to ELMO2 Protein (NBP1-84554PEP).
 

Pathways for ELMO2 Protein (NBP1-84554PEP)

View related products by pathway.

PTMs for ELMO2 Protein (NBP1-84554PEP)

Learn more about PTMs related to ELMO2 Protein (NBP1-84554PEP).
 

Research Areas for ELMO2 Protein (NBP1-84554PEP)

Find related products by research area.

Blogs on ELMO2

There are no specific blogs for ELMO2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ELMO2 Antibody
NB100-879
Rac1 Antibody
NB100-91266

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELMO2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ELMO2