Recombinant Human ELKS Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ELKS Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 91 of Human ERC1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ERC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELKS Protein

  • ELKS/RAB6-interacting/CAST family member 1
  • ELKSCAST2
  • ERC-1
  • FLJ31750
  • KIAA1081Cast2
  • MGC12974
  • RAB6 interacting protein 2
  • Rab6-interacting protein 2
  • RAB6IP2

Background

The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00022999-R01
Species: Hu
NBP2-43633
Species: Hu
Applications: WB, ICC/IF
NBP2-01819
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-62683
Species: Hu
Applications: IHC
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
AF7935
Species: Hu
Applications: IHC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB120-13249
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for ELKS Recombinant Protein (H00023085-P01) (0)

There are no publications for ELKS Recombinant Protein (H00023085-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELKS Recombinant Protein (H00023085-P01) (0)

There are no reviews for ELKS Recombinant Protein (H00023085-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELKS Recombinant Protein (H00023085-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELKS Products

Bioinformatics Tool for ELKS Recombinant Protein (H00023085-P01)

Discover related pathways, diseases and genes to ELKS Recombinant Protein (H00023085-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELKS Recombinant Protein (H00023085-P01)

Discover more about diseases related to ELKS Recombinant Protein (H00023085-P01).
 

Pathways for ELKS Recombinant Protein (H00023085-P01)

View related products by pathway.

PTMs for ELKS Recombinant Protein (H00023085-P01)

Learn more about PTMs related to ELKS Recombinant Protein (H00023085-P01).

Blogs on ELKS

There are no specific blogs for ELKS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ELKS Antibody
NBP1-88177
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ELKS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERC1