ELK3 Antibody (3A12)

Images

 
Western Blot: ELK3 Antibody (3A12) [H00002004-M02] - Analysis of ELK3 expression in transfected 293T cell line by ELK3 monoclonal antibody (M02), clone 3A12.Lane 1: ELK3 transfected lysate(44.2 KDa).Lane 2: ...read more
Sandwich ELISA: ELK3 Antibody (3A12) [H00002004-M02] - Detection limit for recombinant GST tagged ELK3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ELK3 Antibody (3A12) Summary

Immunogen
ELK3 (NP_005221.2, 101 a.a. - 200 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
Specificity
ELK3 - ELK3, ETS-domain protein (SRF accessory protein 2) (3A12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ELK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ELK3 Antibody (3A12)

  • ELK3, ETS-domain protein (SRF accessory protein 2)
  • ERPETS domain-containing protein Elk-3
  • ETS-domain protein
  • ETS-related protein ERP
  • NETSRF accessory protein 2
  • SAP-2
  • SAP2ETS-related protein NET
  • Serum response factor accessory protein 2

Background

The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-59448
Species: Hu
Applications: WB
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87092
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00002004-M02
Species: Hu
Applications: WB, ELISA

Publications for ELK3 Antibody (H00002004-M02) (0)

There are no publications for ELK3 Antibody (H00002004-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELK3 Antibody (H00002004-M02) (0)

There are no reviews for ELK3 Antibody (H00002004-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELK3 Antibody (H00002004-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ELK3 Products

Bioinformatics Tool for ELK3 Antibody (H00002004-M02)

Discover related pathways, diseases and genes to ELK3 Antibody (H00002004-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELK3 Antibody (H00002004-M02)

Discover more about diseases related to ELK3 Antibody (H00002004-M02).
 

Pathways for ELK3 Antibody (H00002004-M02)

View related products by pathway.

PTMs for ELK3 Antibody (H00002004-M02)

Learn more about PTMs related to ELK3 Antibody (H00002004-M02).

Blogs on ELK3

There are no specific blogs for ELK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELK3 Antibody (3A12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ELK3
Entrez
Uniprot