eIF5A2 Antibody (1E7) - Azide and BSA Free

Western Blot: eIF5A2 Antibody (1E7) [H00056648-M01] - Analysis of EIF5A2 expression in transfected 293T cell line by EIF5A2 monoclonal antibody (M01), clone 1E7.Lane 1: EIF5A2 transfected lysate(16.8 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: eIF5A2 Antibody (1E7) [H00056648-M01] - Detection limit for recombinant GST tagged EIF5A2 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 1E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

eIF5A2 Antibody (1E7) - Azide and BSA Free Summary

• Immunogen: EIF5A2 (NP_065123, 66 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
• Specificity: EIF5A2 - eukaryotic translation initiation factor 5A2
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: EIF5A2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for eIF5A2 Antibody (1E7) - Azide and BSA Free

• EIF-5A2
• eIF-5A-2
• eIF5AII
• Eukaryotic initiation factor 5A isoform 2
• eukaryotic initiation factor 5A
• eukaryotic translation initiation factor 5A2
• eukaryotic translation initiation factor 5A-2

Background

Eukaryotic translation initiation factor 5A (eIF5A) is an essential protein tightly linked to cellular polyamine homeostasis. EIF5A2, a novel phylogenetically conserved gene for eIF5A islocalized in an area of the genome often noted for chromosomal instability in cancers. EIF5A2 expression has been observed in testis, brain and colorectal adenocarcinoma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for eIF5A2 Antibody (H00056648-M01)(1)

Publication using H00056648-M01

• Fujimura Ken, Wright Tracy, Strnadel Jan et al. A hypusine-eIF5A-PEAK1 switch regulates the pathogenesis of pancreatic cancer. Cancer Res. 2014-11-15 [PMID: 25261239]

Bioinformatics

• Gene Symbol: EIF5A2
• Entrez:
  • 56648(Human)
• OMIM:
  • 605782(Human)
• Uniprot:
  • NP_065123(Human)