eIF3X Antibody - BSA Free

Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target: CLUH. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Liver Tumor (T-LI). Antibody concentration: 3ug/ml

Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target Name: CLUH. Sample Tissue: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Western Blot: eIF3X Antibody [NBP2-87345] - Host: Rabbit. Target Name: KIAA0664. Sample Tissue: Human A549 Whole Cell. Antibody Dilution: 1ug/ml

Immunoprecipitation: eIF3X Antibody [NBP2-87345] - KIAA0664 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP2-87345 with 1:200 dilution. Western blot was performed using NBP2-87345 at 1/1000 dilution.. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: KIAA0664 IP

• Reactivity: Hu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

eIF3X Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human eIF3X. Peptide sequence: SVFTDGDLGDSGKRKKGLEMDPIDCTPPEYILPGSRERPLCPLQPQNRDW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLUH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for eIF3X Antibody - BSA Free

• CLU1
• DKFZp686L05242
• DKFZp686M09233
• FLJ23672
• hypothetical protein LOC23277
• KIAA0664

Background

eIF3X (putative eukaryotic translation initiation factor 3 subunit) belongs to the eIF-3 p135 family of evolutionarily conserved eIF-3 135kDa subunits found in yeast, nematode, slime mold, and human cells. In yeast, eIF3 p135 is not part of the core eIF-3 complex, but is proposed to be a probable component with unknown function

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CLUH