EIF3F Antibody

Western Blot: EIF3F Antibody [H00008665-B01P] - Analysis of EIF3S5 expression in human spleen.

Immunocytochemistry/Immunofluorescence: EIF3F Antibody [H00008665-B01P] - Analysis of purified antibody to EIF3S5 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: EIF3F Antibody [H00008665-B01P] - Analysis of EIF3F expression in transfected 293T cell line by EIF3F polyclonal antibody. Lane 1: EIF3S5 transfected lysate(39.27 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

EIF3F Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: EIF3S5 (AAH00490, 1 a.a. - 357 a.a.) full-length human protein. MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
• Localization: Cytoplasm.
• Specificity: EIF3S5 - eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: EIF3F
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: -2146826273
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF3F Antibody

• eIF3 p47
• eIF-3-epsilon
• eIF3-epsilon
• eIF3f
• eIF3-p47
• EIF3S5eukaryotic translation initiation factor 3 subunit F
• Eukaryotic translation initiation factor 3 subunit 5
• eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD)
• eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa
• eukaryotic translation initiation factor 3, subunit F

Background

eIF3f, also known as eukaryotic translation initiation factor 3 subunit 5, eIF-3 epsilon, and eIF3 p47 subunit, binds to the 40S ribosome and promotes the binding of methionyl-tRNA and mRNA. EIF3f also associates with the complex p170-eIF3. eIF-3 is composed of at least 12 different subunits, eIF3f is one of these subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF3F
• Entrez:
  • 8665(Human)
• Uniprot:
  • O00303(Human)