EIF2G Antibody - BSA Free

Western Blot: EIF2G Antibody [NBP1-53087] - Jurkat cell lysate, concentration 5.0ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

EIF2G Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to EIF2G (eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa) The peptide sequence was selected from the N terminal of EIF2G. Peptide sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: 3.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF2S3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for EIF2G Antibody - BSA Free

• EIF2
• eIF-2gA
• eIF-2-gamma X
• EIF2gamma
• EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
• eIF-2gX
• eukaryotic translation initiation factor 2 subunit 3
• Eukaryotic translation initiation factor 2 subunit gamma X
• eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
• eukaryotic translation initiation factor 2G

Background

eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF2S3
• Uniprot:
  • P41091(Human)