EIF2G Antibody

Images

 
Western Blot: EIF2G Antibody [NBP1-53087] - Jurkat cell lysate, concentration 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF2G Antibody Summary

Immunogen
Synthetic peptides corresponding to EIF2G (eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa) The peptide sequence was selected from the N terminal of EIF2G. Peptide sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCP
Specificity
This product is specific to Subunit or Isofrom: 3.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2S3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against EIF2G and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EIF2G Antibody

  • EIF2
  • eIF-2gA
  • eIF-2-gamma X
  • EIF2gamma
  • EIF2Geukaryotic translation initiation factor 2, subunit 3 (gamma, 52kD)
  • eIF-2gX
  • eukaryotic translation initiation factor 2 subunit 3
  • Eukaryotic translation initiation factor 2 subunit gamma X
  • eukaryotic translation initiation factor 2, subunit 3 gamma, 52kDa
  • eukaryotic translation initiation factor 2G

Background

eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP2-38572
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16293
Species: Hu
Applications: WB, ICC/IF
NBP2-58544
Species: Hu
Applications: WB, ICC/IF
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
AF3795
Species: Hu
Applications: WB, IP
22240002
Species: Hu
Applications: WB, ELISA
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00004622-R01
Species: Hu
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P

Publications for EIF2G Antibody (NBP1-53087) (0)

There are no publications for EIF2G Antibody (NBP1-53087).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2G Antibody (NBP1-53087) (0)

There are no reviews for EIF2G Antibody (NBP1-53087). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF2G Antibody (NBP1-53087) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF2G Products

Bioinformatics Tool for EIF2G Antibody (NBP1-53087)

Discover related pathways, diseases and genes to EIF2G Antibody (NBP1-53087). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2G Antibody (NBP1-53087)

Discover more about diseases related to EIF2G Antibody (NBP1-53087).
 

Pathways for EIF2G Antibody (NBP1-53087)

View related products by pathway.

PTMs for EIF2G Antibody (NBP1-53087)

Learn more about PTMs related to EIF2G Antibody (NBP1-53087).
 

Research Areas for EIF2G Antibody (NBP1-53087)

Find related products by research area.

Blogs on EIF2G

There are no specific blogs for EIF2G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF2G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S3
Uniprot