Recombinant Human eIF2B4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human eIF2B4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 433-522 of Human EIF2B4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHASLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF2B4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eIF2B4 Protein

  • DKFZp586J0119
  • eIF-2B GDP-GTP exchange factor subunit delta
  • EIF2B
  • EIF-2B
  • EIF2BD
  • EIF2Bdelta
  • eukaryotic translation initiation factor 2B, subunit 4 (delta, 67kD)
  • eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa
  • translation initiation factor eIF-2b delta subunit
  • translation initiation factor eIF-2B subunit delta

Background

EIF2B4 - eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32783
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for eIF2B4 Partial Recombinant Protein (H00008890-Q01) (0)

There are no publications for eIF2B4 Partial Recombinant Protein (H00008890-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF2B4 Partial Recombinant Protein (H00008890-Q01) (0)

There are no reviews for eIF2B4 Partial Recombinant Protein (H00008890-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF2B4 Partial Recombinant Protein (H00008890-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF2B4 Products

Bioinformatics Tool for eIF2B4 Partial Recombinant Protein (H00008890-Q01)

Discover related pathways, diseases and genes to eIF2B4 Partial Recombinant Protein (H00008890-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF2B4 Partial Recombinant Protein (H00008890-Q01)

Discover more about diseases related to eIF2B4 Partial Recombinant Protein (H00008890-Q01).
 

Pathways for eIF2B4 Partial Recombinant Protein (H00008890-Q01)

View related products by pathway.

Blogs on eIF2B4

There are no specific blogs for eIF2B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

4EBP1 Antibody
NB200-157
eIF2B4 Antibody
NBP2-16293

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eIF2B4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2B4