EHD1 Antibody

Images

 
Western Blot: EHD1 Antibody [NBP1-79481] - A549 cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: EHD1 Antibody [NBP1-79481] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, ZeSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EHD1 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human EHD1The immunogen for this antibody is EHD1. Peptide sequence AKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against EHD1 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EHD1 Antibody

  • EH-domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-31896
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1458
Species: Hu
Applications: WB, Flow, ICC/IF, PEP-ELISA
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NBP1-54873
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58295
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
19540002
Species: Hu
Applications: ELISA, IHC, IHC-P
NB100-1269
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-49320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7869
Species: Hu
Applications: WB, ICC
NBP1-57009
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF
H00085377-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-92310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-79481
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC

Publications for EHD1 Antibody (NBP1-79481) (0)

There are no publications for EHD1 Antibody (NBP1-79481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EHD1 Antibody (NBP1-79481) (0)

There are no reviews for EHD1 Antibody (NBP1-79481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EHD1 Antibody (NBP1-79481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EHD1 Products

Bioinformatics Tool for EHD1 Antibody (NBP1-79481)

Discover related pathways, diseases and genes to EHD1 Antibody (NBP1-79481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD1 Antibody (NBP1-79481)

Discover more about diseases related to EHD1 Antibody (NBP1-79481).
 

Pathways for EHD1 Antibody (NBP1-79481)

View related products by pathway.

PTMs for EHD1 Antibody (NBP1-79481)

Learn more about PTMs related to EHD1 Antibody (NBP1-79481).

Blogs on EHD1

There are no specific blogs for EHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD1
Uniprot