EEF2K Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EEF2K Antibody [NBP2-58790] - Staining of human cell line HeLa shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EEF2K Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EEF2K
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EEF2K Recombinant Protein Antigen (NBP2-58790PEP)

Reactivity Notes

Mouse 88%, Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EEF2K Antibody - BSA Free

• Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase
• calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase
• EC 2.7.11
• EC 2.7.11.20
• eEF-2 kinase
• eEF-2Kcalmodulin-dependent protein kinase III
• elongation factor-2 kinase
• eukaroytic elongation factor 2 kinase
• eukaryotic elongation factor 2 kinase
• eukaryotic elongation factor-2 kinase
• HSU93850
• MGC45041

Background

EEF2K encodes a highly conserved protein kinase in the calmodulin-mediated signaling pathway that links activation of cell surface receptors to cell division. This kinase is involved in the regulation of protein synthesis. It phosphorylates eukaryotic elongation factor 2 (EEF2) and thus inhibits the EEF2 function. The activity of this kinase is increased in many cancers and may be a valid target for anti-cancer treatment. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF2K