EEF1G Antibody - BSA Free

Immunohistochemistry-Paraffin: EEF1G Antibody [NBP1-91862] - Staining of human cerebellum, cerebral cortex, lymph node and testis using Anti-EEF1G antibody NBP1-91862 (A) shows similar protein distribution across tissues to independent antibody NBP2-68716 (B).

Western Blot: EEF1G Antibody [NBP1-91862] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: EEF1G Antibody [NBP1-91862] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EEF1G Antibody [NBP1-91862] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: EEF1G Antibody [NBP1-91862] - Staining of human testis.

Immunohistochemistry-Paraffin: EEF1G Antibody [NBP1-91862] - Staining of human cerebellum.

Immunohistochemistry-Paraffin: EEF1G Antibody [NBP1-91862] - Staining of human lymph node.

Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Staining of human cerebellum).

Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Staining of human tonsil shows moderate membranous and cytoplasmic positivity in germinal center cells.

Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EEF1G Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKA
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EEF1G
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EEF1G Protein (NBP1-91862PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EEF1G Antibody - BSA Free

• eEF-1B gamma
• EF-1-gamma
• EF1Gelongation factor 1-gamma
• eukaryotic translation elongation factor 1 gamma
• GIG35
• pancreatic tumor-related protein
• PRO1608
• translation elongation factor eEF-1 gamma chain

Background

EEF1G encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF1G