EEF1G Antibody (2E1O7)

Western Blot: EEF1G Antibody (2E1O7) [NBP3-16694] - Western blot analysis of extracts of various cell lines, using EEF1G Rabbit mAb (NBP3-16694) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunofluorescence analysis of HeLa cells using EEF1G Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunohistochemistry analysis of EEF1G in paraffin-embedded mouse brain tissue using EEF1G Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunohistochemistry analysis of EEF1G in paraffin-embedded human liver tissue using EEF1G Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunohistochemistry analysis of EEF1G in paraffin-embedded rat brain tissue using EEF1G Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunofluorescence analysis of NIH-3T3 cells using EEF1G Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 2E1O7
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

EEF1G Antibody (2E1O7) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human EEF1G (P26641). MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EEF1G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EEF1G Antibody (2E1O7)

• eEF-1B gamma
• EF-1-gamma
• EF1Gelongation factor 1-gamma
• eukaryotic translation elongation factor 1 gamma
• GIG35
• pancreatic tumor-related protein
• PRO1608
• translation elongation factor eEF-1 gamma chain

Background

EEF1G encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF1G