eEF-2 Antibody

Images

 
Independent Antibodies: Western Blot: eEF-2 Antibody [NBP2-57792] - Analysis using Anti-EEF2 antibody NBP2-57792 (A) shows similar pattern to independent antibody NBP2-56755 (B).
Immunocytochemistry/ Immunofluorescence: eEF-2 Antibody [NBP2-57792] - Staining of human cell line HEK 293 shows localization to plasma membrane, cytosol & aggresome.
Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP2-57792] - Immunohistochemical staining of human ovary shows stroma positivity.
Genetic Strategies: Western Blot: eEF-2 Antibody [NBP2-57792] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

eEF-2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHNRLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFG
Specificity
Specificity of human eEF-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EEF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
eEF-2 Recombinant Protein Antigen (NBP2-57792PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for eEF-2 Antibody

  • eEF2
  • eEF-2
  • EF-2
  • EF2EEF-2
  • elongation factor 2
  • eukaryotic translation elongation factor 2
  • polypeptidyl-tRNA translocase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-87019
Species: Hu, Mu
Applications: IP (-), WB, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-1049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-57792
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for eEF-2 Antibody (NBP2-57792) (0)

There are no publications for eEF-2 Antibody (NBP2-57792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eEF-2 Antibody (NBP2-57792) (0)

There are no reviews for eEF-2 Antibody (NBP2-57792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eEF-2 Antibody (NBP2-57792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional eEF-2 Products

Bioinformatics Tool for eEF-2 Antibody (NBP2-57792)

Discover related pathways, diseases and genes to eEF-2 Antibody (NBP2-57792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eEF-2 Antibody (NBP2-57792)

Discover more about diseases related to eEF-2 Antibody (NBP2-57792).
 

Pathways for eEF-2 Antibody (NBP2-57792)

View related products by pathway.

PTMs for eEF-2 Antibody (NBP2-57792)

Learn more about PTMs related to eEF-2 Antibody (NBP2-57792).
 

Research Areas for eEF-2 Antibody (NBP2-57792)

Find related products by research area.

Blogs on eEF-2

There are no specific blogs for eEF-2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eEF-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EEF2