eEF-2 Antibody


Western Blot: eEF-2 Antibody [NBP1-54383] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Immunohistochemistry-Paraffin: eEF-2 Antibody [NBP1-54383] - Human small intestine tissue at an antibody concentration of 5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

eEF-2 Antibody Summary

Synthetic peptides corresponding to EEF2(eukaryotic translation elongation factor 2) The peptide sequence was selected from the N terminal of EEF2. Peptide sequence TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against EEF2 and was validated on Western blot.
Theoretical MW
94 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for eEF-2 Antibody

  • eEF2
  • eEF-2
  • EF-2
  • EF2EEF-2
  • elongation factor 2
  • eukaryotic translation elongation factor 2
  • polypeptidyl-tRNA translocase


EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF

Publications for eEF-2 Antibody (NBP1-54383) (0)

There are no publications for eEF-2 Antibody (NBP1-54383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eEF-2 Antibody (NBP1-54383) (0)

There are no reviews for eEF-2 Antibody (NBP1-54383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eEF-2 Antibody (NBP1-54383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional eEF-2 Products

Bioinformatics Tool for eEF-2 Antibody (NBP1-54383)

Discover related pathways, diseases and genes to eEF-2 Antibody (NBP1-54383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eEF-2 Antibody (NBP1-54383)

Discover more about diseases related to eEF-2 Antibody (NBP1-54383).

Pathways for eEF-2 Antibody (NBP1-54383)

View related products by pathway.

PTMs for eEF-2 Antibody (NBP1-54383)

Learn more about PTMs related to eEF-2 Antibody (NBP1-54383).

Research Areas for eEF-2 Antibody (NBP1-54383)

Find related products by research area.

Blogs on eEF-2

There are no specific blogs for eEF-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our eEF-2 Antibody and receive a gift card or discount.


Gene Symbol EEF2