EDC3 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDC3. Source: E. coli Amino Acid Sequence: IDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
EDC3 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57115. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for EDC3 Recombinant Protein Antigen
Background
EDC3, also known as Enhancer of mRNA-decapping protein 3, is a 508 amino acid that is 56 kDa, located in the cytoplasm and expressed in theca and granulosa cells in ovary, Sertoli cells in testis (at protein level), brain and mammary glands; may play a role in mRNA decapping in the process of mRNA degradation, and also in spermiogenesis and oogenesis. Disease research is currently being studied with relation to central nervous system origin vertigo, patellofemoral pain syndrome and hordeolum. Interactions with the EDC3 protein have been shown to involve YWHAG, YWHAB, ZFP36, SFN, DDX6, YWHAZ, DCP2, UPF1, DCP1B and KBTBD7 in n exonucleolytic nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, gene expression, and mRNA metabolic process pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IP, WB
Species: Hu
Applications: AC
Publications for EDC3 Recombinant Protein Antigen (NBP2-57115PEP) (0)
There are no publications for EDC3 Recombinant Protein Antigen (NBP2-57115PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EDC3 Recombinant Protein Antigen (NBP2-57115PEP) (0)
There are no reviews for EDC3 Recombinant Protein Antigen (NBP2-57115PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for EDC3 Recombinant Protein Antigen (NBP2-57115PEP) (0)
Additional EDC3 Products
Blogs on EDC3