EDC3 Recombinant Protein Antigen

Images

 
There are currently no images for EDC3 Protein (NBP2-30473PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EDC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDC3.

Source: E. coli

Amino Acid Sequence: WLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EDC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30473.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EDC3 Recombinant Protein Antigen

  • enhancer of mRNA decapping 3 homolog (S. cerevisiae)
  • enhancer of mRNA-decapping protein 3
  • FLJ21128
  • FLJ31777
  • hYjeF_N2
  • hYjeF_N2-15q23
  • LSM16 homolog (EDC3, S. cerevisiae)
  • LSM16 homolog
  • LSM16
  • YJDC
  • yjeF domain containing
  • YjeF domain-containing protein 1
  • YjeF N-terminal domain-containing protein 2
  • yjeF_N2
  • YJEFN2yjeF domain containing (E.coli)

Background

EDC3, also known as Enhancer of mRNA-decapping protein 3, is a 508 amino acid that is 56 kDa, located in the cytoplasm and expressed in theca and granulosa cells in ovary, Sertoli cells in testis (at protein level), brain and mammary glands; may play a role in mRNA decapping in the process of mRNA degradation, and also in spermiogenesis and oogenesis. Disease research is currently being studied with relation to central nervous system origin vertigo, patellofemoral pain syndrome and hordeolum. Interactions with the EDC3 protein have been shown to involve YWHAG, YWHAB, ZFP36, SFN, DDX6, YWHAZ, DCP2, UPF1, DCP1B and KBTBD7 in n exonucleolytic nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, gene expression, and mRNA metabolic process pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16109
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, ISH, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-82018
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-13944
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-30626
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB500-191
Species: Hu, Mu
Applications: IP, WB
NBP2-80524
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-81781
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00055802-M06
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-16379
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00056478-B01P
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IP, WB
NBP2-30473PEP
Species: Hu
Applications: AC

Publications for EDC3 Protein (NBP2-30473PEP) (0)

There are no publications for EDC3 Protein (NBP2-30473PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDC3 Protein (NBP2-30473PEP) (0)

There are no reviews for EDC3 Protein (NBP2-30473PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EDC3 Protein (NBP2-30473PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDC3 Products

Blogs on EDC3

There are no specific blogs for EDC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX6 Antibody
NB200-191

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EDC3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EDC3