ECRG4 Antibody - BSA Free

Western Blot: ECRG4 Antibody [NBP1-84911] - Analysis in control (vector only transfected HEK293T lysate) and C2orf40 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: ECRG4 Antibody [NBP1-84911] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: ECRG4 Antibody [NBP1-84911] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: ECRG4 Antibody [NBP1-84911] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: ECRG4 Antibody [NBP1-84911] - Staining of human placenta shows moderate positivity in plasma.

• Reactivity: Hu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ECRG4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KREAPVPTKTKVAVDENKAKEFLGSLKRQKRQLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHGASVNYD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C2ORF40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ECRG4 Recombinant Protein Antigen (NBP1-84911PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%). Rat reactivity reported in scientific literature (PMID: 26150152).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ECRG4 Antibody - BSA Free

• chromosome 2 open reading frame 40
• ECRG4augurin
• esophageal cancer related gene 4 protein
• Esophageal cancer-related gene 4 protein

Background

ECRG4, also known as C2orf40 or Chromosome 2 Open Reading Frame 40, is a secreted hormone that may stimulate senescence of neural precursor cells and oligodendrocytes. Current research on ECRG4is being performed in relation to several diseases and disorders including esophageal cancer, esophagitis and breast cancer. ECRG4 has also been shown to interact with p53.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ECRG4 Antibody (NBP1-84911)(2)

Publications using NBP1-84911

• Porzionato A, Rucinski M, Macchi V et al. ECRG4 Expression in Normal Rat Tissues: Expression Study and Literature Review. Eur J Histochem 2015-05-18 [PMID: 26150152] (IF/IHC, Rat)
• Baird A, Coimbra R, Dang X et al. Cell surface localization and release of the candidate tumor suppressor Ecrg4 from polymorphonuclear cells and monocytes activate macrophages. J Leukoc Biol 2012-05-01 [PMID: 22396620]

Bioinformatics

• Gene Symbol: C2ORF40