ECHS1 Antibody (3C6)

Images

 
ELISA: ECHS1 Antibody (3C6) [H00001892-M05] - Detection limit for recombinant GST tagged ECHS1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3C6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ECHS1 Antibody (3C6) Summary

Immunogen
ECHS1 (AAH08906, 13 a.a. - 290 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ
Specificity
ECHS1 - enoyl Coenzyme A hydratase, short chain, 1, mitochondrial (3C6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ECHS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.
Publications
Read Publication using H00001892-M05.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ECHS1 Antibody (3C6)

  • EC 4.2.1
  • enoyl CoA hydratase, short chain, 1, mitochondrial
  • enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
  • Enoyl-CoA hydratase 1
  • enoyl-CoA hydratase, mitochondrial
  • SCEHEC 4.2.1.17
  • Short-chain enoyl-CoA hydratase

Background

The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84915
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-57292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-16429
Species: Hu
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-55323
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59645
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59576
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Sh, Ze
Applications: WB, IHC
NBP2-75478
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-56808
Species: Hu, Mu, Rt, Ca, GP, Rb
Applications: WB
NBP1-83215
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-55460
Species: Hu
Applications: WB, ICC/IF
H00001892-M05
Species: Hu
Applications: ELISA

Publications for ECHS1 Antibody (H00001892-M05)(1)


Showing Publication 1 - 1 of 1.
Publication using H00001892-M05 Applications Species
Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018

Reviews for ECHS1 Antibody (H00001892-M05) (0)

There are no reviews for ECHS1 Antibody (H00001892-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ECHS1 Antibody (H00001892-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ECHS1 Products

Bioinformatics Tool for ECHS1 Antibody (H00001892-M05)

Discover related pathways, diseases and genes to ECHS1 Antibody (H00001892-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECHS1 Antibody (H00001892-M05)

Discover more about diseases related to ECHS1 Antibody (H00001892-M05).
 

Pathways for ECHS1 Antibody (H00001892-M05)

View related products by pathway.

PTMs for ECHS1 Antibody (H00001892-M05)

Learn more about PTMs related to ECHS1 Antibody (H00001892-M05).
 

Research Areas for ECHS1 Antibody (H00001892-M05)

Find related products by research area.

Blogs on ECHS1

There are no specific blogs for ECHS1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECHS1 Antibody (3C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol ECHS1
Entrez
Uniprot