ECHDC1 Antibody

Images

 
Immunohistochemistry: ECHDC1 Antibody [NBP1-85179] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ECHDC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ECHDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ECHDC1 Protein (NBP1-85179PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ECHDC1 Antibody

  • dJ351K20.2
  • DKFZp762M1110
  • enoyl CoA hydratase domain containing 1
  • enoyl Coenzyme A hydratase domain containing 1
  • enoyl-CoA hydratase domain-containing protein 1
  • FLJ40827

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85886
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00005095-B01P
Species: Hu
Applications: WB
AF1936
Species: Hu
Applications: WB, IP
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87423
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01859
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54755
Species: Hu
Applications: WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ECHDC1 Antibody (NBP1-85179) (0)

There are no publications for ECHDC1 Antibody (NBP1-85179).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECHDC1 Antibody (NBP1-85179) (0)

There are no reviews for ECHDC1 Antibody (NBP1-85179). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ECHDC1 Antibody (NBP1-85179) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ECHDC1 Products

Bioinformatics Tool for ECHDC1 Antibody (NBP1-85179)

Discover related pathways, diseases and genes to ECHDC1 Antibody (NBP1-85179). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ECHDC1 Antibody (NBP1-85179)

Discover more about diseases related to ECHDC1 Antibody (NBP1-85179).
 

Pathways for ECHDC1 Antibody (NBP1-85179)

View related products by pathway.

PTMs for ECHDC1 Antibody (NBP1-85179)

Learn more about PTMs related to ECHDC1 Antibody (NBP1-85179).
 

Research Areas for ECHDC1 Antibody (NBP1-85179)

Find related products by research area.

Blogs on ECHDC1

There are no specific blogs for ECHDC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ECHDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ECHDC1