ECH1 Antibody Summary
Immunogen |
ECH1 (NP_001389.2, 1 a.a. - 328 a.a.) full-length human protein. MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
Specificity |
ECH1 - enoyl Coenzyme A hydratase 1, peroxisomal, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ECH1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Control |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ECH1 Antibody
Background
This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
Publications for ECH1 Antibody (H00001891-D01P) (0)
There are no publications for ECH1 Antibody (H00001891-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ECH1 Antibody (H00001891-D01P) (0)
There are no reviews for ECH1 Antibody (H00001891-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ECH1 Antibody (H00001891-D01P) (0)
Control Lysate(s)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional ECH1 Products
Bioinformatics Tool for ECH1 Antibody (H00001891-D01P)
Discover related pathways, diseases and genes to ECH1 Antibody (H00001891-D01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for ECH1 Antibody (H00001891-D01P)
Discover more about diseases related to ECH1 Antibody (H00001891-D01P).
| | Pathways for ECH1 Antibody (H00001891-D01P)
View related products by pathway.
|
PTMs for ECH1 Antibody (H00001891-D01P)
Learn more about PTMs related to ECH1 Antibody (H00001891-D01P).
| | Research Areas for ECH1 Antibody (H00001891-D01P)
Find related products by research area.
|
Blogs on ECH1