ECEL1 Recombinant Protein Antigen

Images

 
There are currently no images for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ECEL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ECEL1

Source: E.coli

Amino Acid Sequence: LFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEDSEKILAAYRVFMERVLSLLGADAVEQKAQEILQVEQQLANITVSEHDDLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ECEL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17582. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ECEL1 Recombinant Protein Antigen

  • damage induced neuronal endopeptidase
  • DINE
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.11
  • ECEX
  • endothelin converting enzyme-like 1
  • endothelin-converting enzyme-like 1
  • Xce protein
  • XCEX converting enzyme

Background

ECEL1 encodes a member of the M13 family of endopeptidases. In general, M13 family members are zinc-containing type II integral-membrane proteins that are important regulators of neuropeptide and peptide hormone activity. This gene is expressed specifically in the central nervous system and its protein localizes predominately to the endoplasmic reticulum or, in trace amounts, to the cell surface. Disruption of this gene in mouse embryonic stem cells results in neonatal lethality due to respiratory failure shortly after birth. Based on the specific expression of this gene and the phenotype of the gene deficiency in mouse embryos, it is suggested that this protein plays a critical role in neural regulation of the respiratory system. This gene has multiple pseudogenes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
AF1784
Species: Hu
Applications: CyTOF-ready, IHC, IP, ICFlow, WB
AF2396
Species: Hu
Applications: IHC, Simple Western, WB
QET00B
Species: Hu
Applications: ELISA
7734-LF
Species: Hu
Applications: BA
8090-ZN
Species: Hu
Applications: EnzAct
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC,  IHC-P
NBP1-85816
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KO, WB
M6000B
Species: Mu
Applications: ELISA
AF2340
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
H00001908-M01
Species: Hu
Applications: ELISA, IP, WB
NBP3-17582PEP
Species: Hu
Applications: AC

Publications for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP) (0)

There are no publications for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP) (0)

There are no reviews for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ECEL1 Products

Research Areas for ECEL1 Recombinant Protein Antigen (NBP3-17582PEP)

Find related products by research area.

Blogs on ECEL1

There are no specific blogs for ECEL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ECEL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ECEL1