EB2 Antibody (4D7) - Azide and BSA Free

Western Blot: EB2 Antibody (4D7) [H00010982-M03] - Analysis of MAPRE2 expression in K-562 (Cat # L009V1).

Immunocytochemistry/Immunofluorescence: EB2 Antibody (4D7) [H00010982-M03] - Analysis of monoclonal antibody to MAPRE2 on HeLa cell. Antibody concentration 35 ug/ml

Immunohistochemistry-Paraffin: EB2 Antibody (4D7) [H00010982-M03] - Analysis of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml

Western Blot: EB2 Antibody (4D7) [H00010982-M03] - Analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody (M03), clone 4D7. Lane 1: MAPRE2 transfected lysate (Predicted MW: 37 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 4D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EB2 Antibody (4D7) - Azide and BSA Free Summary

• Immunogen: MAPRE2 (NP_055083, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD
• Specificity: MAPRE2 (4D7)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAPRE2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EB2 Antibody (4D7) - Azide and BSA Free

• APC-binding protein EB2
• EB1
• EB2APC-binding protein EB1
• End-binding protein 2
• microtubule-associated protein, RP/EB family, member 2
• RP1microtubule-associated protein RP/EB family member 2
• T-cell activation protein, EB1 family

Background

The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPRE2
• Entrez:
  • 10982(Human)
• OMIM:
  • 605789(Human)
• Uniprot:
  • NP_055083(Human)