We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

EAAT3 Antibody

Images

 
Western Blot: EAAT3 Antibody [NBP1-84938] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: EAAT3 Antibody [NBP1-84938] - Staining of human small intestine shows strong luminal membranous positivity in glandular

Product Details

Summary
Product Discontinued
View other related EAAT3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-84938
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

EAAT3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC1A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EAAT3 Antibody

  • EAAC1
  • EAAC1excitatory amino acid carrier 1
  • EAAT3
  • EAAT3excitatory amino acid transporter 3
  • Excitatory amino-acid carrier 1
  • Neuronal and epithelial glutamate transporter
  • SLC1A1
  • Sodium-dependent glutamate/aspartate transporter 3
  • solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1
  • Solute carrier family 1 member 1

Background

The EAAT3 gene encodes for glutamate transporters (also known as excitatory amino acid transporters, EAATs), that rapidly move glutamate from the postsynaptic cleft through the plasma membrane. The proteins are approximately 542 amino acids long at a mass barely over 57 kDA. This function allows for neurotoxic levels of glutamate in the brain to be avoided. It is common to see underactivity of glutamate receptors in some disorders such as ischemia and traumatic brain injuries and overactivity to be linked to mental illnesses such as schizophrenia. EAAT3 gene is also related to obsessive-compulsive disorder, ganglioglioma, autism spectrum disorders, aminoaciduriam temporal lobe epilepsy, hepatic encephalopathy, neuronitis, anorexia nervosa, and amyotrophic lateral sclerosis. It interacts with KNCN, HCCS, EWSR1, PRKCA, and ARL6IP5 to function in pathways of glutamic acid signaling, transmembrane transport of small molecules, and protein digestion and absorption.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, In vivo, ISH, WB
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-91803
Species: Hu
Applications: IHC,  IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP3-12158
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-81802
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-13165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84938
Species: Hu
Applications: WB, IHC

Publications for EAAT3 Antibody (NBP1-84938) (0)

There are no publications for EAAT3 Antibody (NBP1-84938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAAT3 Antibody (NBP1-84938) (0)

There are no reviews for EAAT3 Antibody (NBP1-84938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EAAT3 Antibody (NBP1-84938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EAAT3 Products

Research Areas for EAAT3 Antibody (NBP1-84938)

Find related products by research area.

Blogs on EAAT3

There are no specific blogs for EAAT3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EAAT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A1