E2F-2 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human E2F-2 (NP_004082). Peptide sequence DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLI |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
E2F2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry
- Western Blot 1.0 ug/ml
|
| Theoretical MW |
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for E2F-2 Antibody - BSA Free
Background
E2F transcription factors are functionally regulated by binding to Rb p110, p107, and p130. E2F2 is regulated by complex formation with Rb p110. E2F family members bind DNA as heterodimers with members of the DP family of polypeptides.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB, IHC
Publications for E2F-2 Antibody (NBP3-10478) (0)
There are no publications for E2F-2 Antibody (NBP3-10478).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for E2F-2 Antibody (NBP3-10478) (0)
There are no reviews for E2F-2 Antibody (NBP3-10478).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for E2F-2 Antibody (NBP3-10478) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional E2F-2 Products
Research Areas for E2F-2 Antibody (NBP3-10478)
Find related products by research area.
|
Blogs on E2F-2