E2F-1 Recombinant Protein Antigen

Images

 
There are currently no images for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

E2F-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to E2F-1.

Source: E. coli

Amino Acid Sequence: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
E2F1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56716.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for E2F-1 Recombinant Protein Antigen

  • E2F transcription factor 1
  • E2F1
  • E2F-1
  • PBR3
  • PRB-binding protein E2F-1
  • RBAP1
  • RBAP-1
  • RBBP3
  • RBBP-3
  • RBP3
  • Retinoblastoma-associated protein 1
  • Retinoblastoma-binding protein 3
  • transcription factor E2F1

Background

E2F1 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6495
Species: Hu
Applications: ICC, Simple Western, WB
NBP1-26616
Species: Hu
Applications: IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-21374
Species: Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF4196
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-80295
Species: Hu, Mu
Applications: WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
AF5119
Species: Hu
Applications: WB
NBP2-33735
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-92787
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-56716PEP
Species: Hu
Applications: AC

Publications for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP) (0)

There are no publications for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP) (0)

There are no reviews for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional E2F-1 Products

Research Areas for E2F-1 Recombinant Protein Antigen (NBP2-56716PEP)

Find related products by research area.

Blogs on E2F-1

There are no specific blogs for E2F-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our E2F-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F1