DZIP3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SYYNHLWTNHPLGGSWHLLYPPNKELPQSKQFDLCLLLALIKHLNVFPAPKKGWNMEPPSSDISKSADILRLCKYRDILLSEILMNGLTESQFNSIWK |
| Predicted Species |
Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DZIP3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DZIP3 Antibody - BSA Free
Background
The DZIP3 gene codes a E3 ubiquitin-protein ligase DZIP3 protein that in one isoform is 1,208 amino acids long and 138 kDA and in the other is 303 amino acids long at 35 kDA. These proteins are able to specifically bind RNA as well as control ubiquitination and proteasomal degradation of target proteins by receiving ubiquitin from an E2 ubiquitin-conjugating enzyme (in the form of a thioester) then transfers the material to targeted substrates. DZIP3 is active in adaptive immune system, protein modification, and antigen processing (specifically ubiquitination and proteasome degradation as described above). DZIP3 has been researched in various diseases such as azoospermia and ataxia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for DZIP3 Antibody (NBP1-81698) (0)
There are no publications for DZIP3 Antibody (NBP1-81698).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DZIP3 Antibody (NBP1-81698) (0)
There are no reviews for DZIP3 Antibody (NBP1-81698).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DZIP3 Antibody (NBP1-81698) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DZIP3 Products
Research Areas for DZIP3 Antibody (NBP1-81698)
Find related products by research area.
|
Blogs on DZIP3