dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen

Images

 
There are currently no images for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human dystrophia myotonica containing WD repeat motif.

Source: E. coli

Amino Acid Sequence: EPGTPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DMWD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49548.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen

  • D19S593E
  • DM9
  • DMRN9
  • DMR-N9
  • dystrophia myotonica WD repeat-containing protein
  • dystrophia myotonica, WD repeat containing
  • Dystrophia myotonica-containing WD repeat motif protein
  • dystrophia myotonica-containing WD repeat motif
  • gene59
  • Protein 59
  • Protein DMR-N9

Background

The gene that codes for DMWD (dystrophia myotonica WD-repeat containing protein) is located in the myotonic dystrophy (DM1) gene cluster on 19q. Mutations in the DM1 region affect DMPK (myotonic dystrophy protein kinase), a myosin kinase expressed in skeletal muscle, and are the cause of myotonic dystrophy, a form of muscular dystrophy characterized by wasting of the muscles and myotonia. DMWD is expressed ubiquitously and is most abundant in the testes and brain. Studies concerning its abundance and sub-cellular localization in brain tissue suggest that it may have a role in some of the mental symptoms associated with myotonic dystrophy. Alternate names for DMWD include DMR-N9, and DM9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
NBP1-85009
Species: Hu, Mu
Applications: IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-33538
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16669
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
612-CD
Species: Hu
Applications: BA
NBP1-87964
Species: Hu
Applications: IHC, IHC-P
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-49409
Species: Hu
Applications: IHC, IHC-P
NBP2-92206
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP3-35142
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-49548PEP
Species: Hu
Applications: AC

Publications for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP) (0)

There are no publications for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP) (0)

There are no reviews for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional dystrophia myotonica containing WD repeat motif Products

Research Areas for dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen (NBP2-49548PEP)

Find related products by research area.

Blogs on dystrophia myotonica containing WD repeat motif

There are no specific blogs for dystrophia myotonica containing WD repeat motif, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our dystrophia myotonica containing WD repeat motif Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DMWD