Dystroglycan Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Dystroglycan Antibody [NBP3-17837] - Staining of human cell line HaCaT shows localization to nucleoplasm, plasma membrane & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dystroglycan Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dystroglycan Antibody - BSA Free (NBP3-17837) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHY
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DAG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dystroglycan Antibody - BSA Free

• A3a
• AGRNR
• DAG1
• Dag-1
• DAG156DAG
• dystroglycan 1 (dystrophin-associated glycoprotein 1)
• Dystroglycan
• Dystrophin-associated glycoprotein 1

Background

Dystroglycan (also known as dystrophin-associated glycoprotein 1) is a member of the dystroglycan family that contains the WWW binding motif PPxY. This protein has alpha and beta subunits with approximate molecular weights of 156 kD and 43-50 kD, respectively. The dystroglycan beta subunit is an integral membrane protein, the alpha subunit is a ubiquitously expressed extracellular protein. Muscle and non-muscle isoforms differ by carbohydrate moieties (not protein sequence). Dystroglycan functions as an adhesion molecule responsible for interactions between extracellular matrix and the subsarcolemmal cytoskeleton. Dsytroglycan binds to lamin in the matrix and dystrophin in the cytoskeleton; phosphorylation regulates the association of interacting proteins. Dystroglycan binds to utrophin when unphosphorylated; c-Src, Fyn, Csk, NCK, and SHC when phosphorylated. Dystroglycan interacts with dystrophin through the WW domain. The Poly6171 antibody recognizes human phosphorylated dystroglycan (Tyr893) and has been shown to be useful for Western blotting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAG1