Dystroglycan Antibody

Images

 
Western Blot: Dystroglycan Antibody [NBP1-69017] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dystroglycan Antibody Summary

Immunogen
Synthetic peptides corresponding to Dag1 (dystroglycan 1) The peptide sequence was selected from the C terminal of Dag1. Peptide sequence PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DAG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Dag1 and was validated on Western blot.
Theoretical MW
97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dystroglycan Antibody

  • A3a
  • AGRNR
  • DAG1
  • Dag-1
  • DAG156DAG
  • dystroglycan 1 (dystrophin-associated glycoprotein 1)
  • Dystroglycan
  • Dystrophin-associated glycoprotein 1

Background

The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sacrolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization.Alpha-dystroglycan is an extracellular peripheral glycoprotein that acts as a receptor for both extracellular matrix proteins containing laminin-G domains, and for certain adenoviruses. Receptor for laminin-2 (LAMA2) and agrin in peripheral nerve Schwann cells. Also receptor for lymphocytic choriomeningitis virus, Old World Lassa fever virus, and clade C New World arenaviruses.Beta-dystroglycan is a transmembrane protein that plays important roles in connecting the extracellular matrix to the cytoskeleton. Acts as a cell adhesion receptor in both muscle and non-muscle tissues. Receptor for both DMD and UTRN and, through these interactions, scaffolds axin to the cytoskeleton. Also functions in cell adhesion-mediated signaling and implicated in cell polarity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
AF2364
Species: Hu
Applications: WB, IHC
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005554-R02
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-69017
Species: Mu
Applications: WB

Publications for Dystroglycan Antibody (NBP1-69017) (0)

There are no publications for Dystroglycan Antibody (NBP1-69017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystroglycan Antibody (NBP1-69017) (0)

There are no reviews for Dystroglycan Antibody (NBP1-69017). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dystroglycan Antibody (NBP1-69017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dystroglycan Products

Bioinformatics Tool for Dystroglycan Antibody (NBP1-69017)

Discover related pathways, diseases and genes to Dystroglycan Antibody (NBP1-69017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystroglycan Antibody (NBP1-69017)

Discover more about diseases related to Dystroglycan Antibody (NBP1-69017).
 

Pathways for Dystroglycan Antibody (NBP1-69017)

View related products by pathway.

PTMs for Dystroglycan Antibody (NBP1-69017)

Learn more about PTMs related to Dystroglycan Antibody (NBP1-69017).

Blogs on Dystroglycan.

Could Laminin be Used to Treat Duchenne Muscular Dystrophy?
Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dystroglycan Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DAG1
Entrez
Uniprot