Dystroglycan Antibody


Western Blot: Dystroglycan Antibody [NBP1-69017] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Reactivity MuSpecies Glossary
Applications WB
Please see the vial label for concentration. If unlisted please contact technical services.

Order Details

Dystroglycan Antibody Summary

Synthetic peptides corresponding to Dag1 (dystroglycan 1) The peptide sequence was selected from the C terminal of Dag1. Peptide sequence PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Please see the vial label for concentration. If unlisted please contact technical services.
Immunogen affinity purified


Application Notes
This is a rabbit polyclonal antibody against Dag1 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
97 kDa


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Dystroglycan Antibody

  • A3a
  • DAG1
  • Dag-1
  • DAG156DAG
  • dystroglycan 1 (dystrophin-associated glycoprotein 1)
  • dystroglycan
  • Dystrophin-associated glycoprotein 1


The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sacrolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization.Alpha-dystroglycan is an extracellular peripheral glycoprotein that acts as a receptor for both extracellular matrix proteins containing laminin-G domains, and for certain adenoviruses. Receptor for laminin-2 (LAMA2) and agrin in peripheral nerve Schwann cells. Also receptor for lymphocytic choriomeningitis virus, Old World Lassa fever virus, and clade C New World arenaviruses.Beta-dystroglycan is a transmembrane protein that plays important roles in connecting the extracellular matrix to the cytoskeleton. Acts as a cell adhesion receptor in both muscle and non-muscle tissues. Receptor for both DMD and UTRN and, through these interactions, scaffolds axin to the cytoskeleton. Also functions in cell adhesion-mediated signaling and implicated in cell polarity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, MiAr
Species: Hu
Applications: WB, ELISA, PA
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: PAGE
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for Dystroglycan Antibody (NBP1-69017) (0)

There are no publications for Dystroglycan Antibody (NBP1-69017).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystroglycan Antibody (NBP1-69017) (0)

There are no reviews for Dystroglycan Antibody (NBP1-69017). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dystroglycan Antibody (NBP1-69017) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Dystroglycan Antibody Products

Related Products by Gene

Bioinformatics Tool for Dystroglycan Antibody (NBP1-69017)

Discover related pathways, diseases and genes to Dystroglycan Antibody (NBP1-69017). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystroglycan Antibody (NBP1-69017)

Discover more about diseases related to Dystroglycan Antibody (NBP1-69017).

Pathways for Dystroglycan Antibody (NBP1-69017)

View related products by pathway.

PTMs for Dystroglycan Antibody (NBP1-69017)

Learn more about PTMs related to Dystroglycan Antibody (NBP1-69017).

Blogs on Dystroglycan.

Could Laminin be Used to Treat Duchenne Muscular Dystrophy?
Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or...  Read full blog post.

Contact Information

Product PDFs


Gene Symbol DAG1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-69017 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought