Dystrobrevin alpha Antibody - BSA Free

Western Blot: Dystrobrevin alpha Antibody [NBP3-10865] - Western blot analysis of Dystrobrevin alpha in Mouse Thymus lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Dystrobrevin alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dystrobrevin alpha Antibody - BSA Free (NBP3-10865) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Dystrobrevin alpha (NP_001272736.1). Peptide sequence DCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHP
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DTNA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 75 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Dystrobrevin alpha Antibody - BSA Free

• Alpha-dystrobrevin
• D18S892EDTN
• DRP3FLJ96209
• DTN-1
• DTN-2
• DTN-3
• DTN-A
• dystrobrevin alpha
• dystrobrevin, alpha
• Dystrophin-related protein 3
• LVNC1

Background

Dystrobrevin alpha is encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTNA