Dynein heavy chain Recombinant Protein Antigen

Images

 
There are currently no images for Dynein heavy chain Protein (NBP2-38671PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Dynein heavy chain Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAH9.

Source: E. coli

Amino Acid Sequence: YNLSQPLLKRDPETKEITINFNPQLISVLKEMSYLEPREMKHMPETAAAMFSSRDFYRQLVANLELMANWYNKVMKTLL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAH9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38671.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dynein heavy chain Recombinant Protein Antigen

  • axonemal, heavy polypeptide 9
  • ciliary dynein heavy chain 9
  • DNAH9 variant protein
  • DYH9
  • dynein heavy chain 9, axonemal
  • dynein, axonemal, heavy chain 9
  • HL20

Background

Dynein heavy chain 9, axonemal is a protein that has three isoforms, with lengths of 4486, 4410, and 798 amino acids and weights of approximately 512, 503, and 798 kDa respectively. Dynein heavy chain generates force at the minus end of the microtubules that make up cilia which occurs due to the use of ADP that dynein obtains through ATPase activity. Current research is being done on diseases and disorders linked to this protein including ciliary dyskinesia, Kartagener syndrome, bronchiectasis, and malaria. Dynein heavy chain has also been shown to have interactions with BCL6, DNAH1, DNAH17, DNAH2, and DNAH3 in pathways such as the cytoplasmic microtubules pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15698
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84463
Species: Hu
Applications: IHC,  IHC-P, IP
NBP1-84466
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-93834
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DY393
Species: Hu
Applications: ELISA
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP2-45945
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
NBP2-92787
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-84297
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP1-89483
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38671PEP
Species: Hu
Applications: AC

Publications for Dynein heavy chain Protein (NBP2-38671PEP) (0)

There are no publications for Dynein heavy chain Protein (NBP2-38671PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dynein heavy chain Protein (NBP2-38671PEP) (0)

There are no reviews for Dynein heavy chain Protein (NBP2-38671PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dynein heavy chain Protein (NBP2-38671PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dynein heavy chain Products

Blogs on Dynein heavy chain

There are no specific blogs for Dynein heavy chain, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dynein heavy chain Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH9