DYNC1H1 Antibody - Azide and BSA Free Summary
| Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen |
DYNC1H1 (AAH64521.1, 1 a.a. - 197 a.a.) full-length human protein. MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWLHLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV |
| Specificity |
DYNC1H1 - dynein, cytoplasmic 1, heavy chain 1, |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DYNC1H1 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for DYNC1H1 Antibody - Azide and BSA Free
Background
Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains.This gene encodes a member of the cytoplasmic dynein heavy chain family. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for DYNC1H1 Antibody (H00001778-D01P) (0)
There are no publications for DYNC1H1 Antibody (H00001778-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DYNC1H1 Antibody (H00001778-D01P) (0)
There are no reviews for DYNC1H1 Antibody (H00001778-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for DYNC1H1 Antibody (H00001778-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DYNC1H1 Products
Research Areas for DYNC1H1 Antibody (H00001778-D01P)
Find related products by research area.
|
Blogs on DYNC1H1