DYM Recombinant Protein Antigen

Images

 
There are currently no images for DYM Protein (NBP2-13942PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DYM Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DYM.

Source: E. coli

Amino Acid Sequence: MTRTRDKYLHTNCLAALANMSAQFRSLHQYAAQRIISLFSLLSKKHNKVLEQATQSLRGSLSSNDVPLPDYAQDLNVIEEVIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DYM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13942.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DYM Recombinant Protein Antigen

  • DMCSMCFLJ20071
  • Dyggve-Melchior-Clausen syndrome protein
  • dymeclin
  • FLJ90130

Background

The DYM gene encodes for a protein that is critical for correct organization of Golgi apparatus and is involved in skeletal development and brain functioning. Isoform 1 of this protein is 669 amino acids long at nearly 76 kDA while isoform 2 is 479 amino acids long at approximately 54 kDA. DYM is known to interact with ACO2, C12orf4, SPAG9, GMPS, and TBC1D22B genes. Defects in the DYM gene are known to cause Dyggve-Melchior-Clausen syndrome as well as Smith-McCort Dysplasia. DYM has also been investigated for its role in various diseases such as thyroiditis, acromegaly, dwarfism, gangliosidosis, turner syndrome, atherosclerosis, microencephaly, intellectual disabilities, and sponastrime dysplasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
AF009
Species: Hu
Applications: IHC, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-469
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81838
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
DHAPG0
Species: Hu
Applications: ELISA
AF2009
Species: Hu
Applications: ICC, IHC
NBP1-76263
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB100-204
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P

Publications for DYM Protein (NBP2-13942PEP) (0)

There are no publications for DYM Protein (NBP2-13942PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DYM Protein (NBP2-13942PEP) (0)

There are no reviews for DYM Protein (NBP2-13942PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DYM Protein (NBP2-13942PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DYM Products

Array NBP2-13942PEP

Blogs on DYM

There are no specific blogs for DYM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DYM Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DYM