ZCCHC24 Antibody

Images

 
Western Blot: ZCCHC24 Antibody [NBP1-88536] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ZCCHC24 Antibody [NBP1-88536] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: ZCCHC24 Antibody [NBP1-88536] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZCCHC24 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMSGNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZCCHC24
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZCCHC24 Protein (NBP1-88536PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZCCHC24 Antibody

  • C10orf56
  • chromosome 10 open reading frame 56
  • FLJ90798
  • zinc finger CCHC domain-containing protein 24
  • zinc finger, CCHC domain containing 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41344
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, MiAr, PA
AF3927
Species: Hu, Mu, Rt
Applications: WB
NBP1-98277
Species: Hu
Applications: WB
NBP1-90896
Species: Hu
Applications: IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88779
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58228
Species: Hu
Applications: ICC/IF
AF8107
Species: Hu
Applications: WB, IHC
NBP2-38377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86202
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ZCCHC24 Antibody (NBP1-88536) (0)

There are no publications for ZCCHC24 Antibody (NBP1-88536).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZCCHC24 Antibody (NBP1-88536) (0)

There are no reviews for ZCCHC24 Antibody (NBP1-88536). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZCCHC24 Antibody (NBP1-88536) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZCCHC24 Products

Bioinformatics Tool for ZCCHC24 Antibody (NBP1-88536)

Discover related pathways, diseases and genes to ZCCHC24 Antibody (NBP1-88536). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZCCHC24

There are no specific blogs for ZCCHC24, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZCCHC24 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZCCHC24